Lineage for d3lpla1 (3lpl A:56-470)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2108258Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2108259Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2108664Family c.36.1.10: TK-like PP module [88760] (3 protein domains)
    different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain
  6. 2108715Protein automated matches [254698] (2 species)
    not a true protein
  7. 2108716Species Escherichia coli [TaxId:83334] [255937] (3 PDB entries)
  8. 2108721Domain d3lpla1: 3lpl A:56-470 [247486]
    Other proteins in same PDB: d3lpla2, d3lpla3, d3lplb2, d3lplb3
    automated match to d2ieaa2
    complexed with epe, mg, po4, tdp; mutant

Details for d3lpla1

PDB Entry: 3lpl (more details), 2.1 Å

PDB Description: E. coli pyruvate dehydrogenase complex E1 component E571A mutant
PDB Compounds: (A:) Pyruvate dehydrogenase E1 component

SCOPe Domain Sequences for d3lpla1:

Sequence, based on SEQRES records: (download)

>d3lpla1 c.36.1.10 (A:56-470) automated matches {Escherichia coli [TaxId: 83334]}
isnyintipveeqpeypgnlelerrirsairwnaimtvlraskkdlelgghmasfqssat
iydvcfnhffrarneqdggdlvyfqghispgvyaraflegrltqeqldnfrqevhgngls
syphpklmpefwqfptvsmglgpigaiyqakflkylehrglkdtskqtvyaflgdgemde
peskgaitiatrekldnlvfvincnlqrldgpvtgngkiinelegifegagwnvikvmwg
srwdellrkdtsgkliqlmnetvdgdyqtfkskdgayvrehffgkypetaalvadwtdeq
iwalnrgghdpkkiyaafkkaqetkgkatvilahtikgygmgdaaegkniahqvkkmnmd
gvrhirdrfnvpvsdadieklpyitfpegseehtylhaqrqklhgylpsrqpnft

Sequence, based on observed residues (ATOM records): (download)

>d3lpla1 c.36.1.10 (A:56-470) automated matches {Escherichia coli [TaxId: 83334]}
isnyintipveeqpeypgnlelerrirsairwnaimtvlraskkdlelgghmasfqssat
iydvcfnhffrarneqdggdlvyfqghispgvyaraflegrltqeqldnfrqevhgngls
syphpklmpefwqfptvsmglgpigaiyqakflkylehrglkdtskqtvyaflgdgemde
peskgaitiatrekldnlvfvincnlqrldgpvtgngkiinelegifegagwnvikvmwg
srwdellrkdtsgkliqlmnetvdgdyqtfkskdgayvrehffgkypetaalvadwtdeq
iwalnrgghdpkkiyaafkkaqetkgkatvilahtikgygmgdaamdgvrhirdrfnvpv
sdadieklpyitfpegseehtylhaqrqklhgylpsrqpnft

SCOPe Domain Coordinates for d3lpla1:

Click to download the PDB-style file with coordinates for d3lpla1.
(The format of our PDB-style files is described here.)

Timeline for d3lpla1: