SCOPe 2.08: Domain d3lp8a1: 3lp8 A:1-101

Lineage for d3lp8a1 (3lp8 A:1-101)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (40 species)
   not a true protein

7. Species Ehrlichia chaffeensis [TaxId:205920] [255934] (1 PDB entry)

8. Domain d3lp8a1: 3lp8 A:1-101 [247483]
   Other proteins in same PDB: d3lp8a2, d3lp8a3, d3lp8a4
   automated match to d1gsoa2
   complexed with po4, unx

Details for d3lp8a1

PDB Entry: 3lp8, 2.15 Å

PDB Description: Crystal structure of phosphoribosylamine-glycine ligase from Ehrlichia chaffeensis

PDB Compounds: (A:) Phosphoribosylamine-glycine ligase

SCOPe Domain Sequences for d3lp8a1:

Sequence; same for both SEQRES and ATOM records:

>d3lp8a1 c.30.1.0 (A:1-101) automated matches {Ehrlichia chaffeensis [TaxId: 205920]}
mnvlvigsggrehsmlhhirkstllnklfiapgregmsgladiididinstieviqvckk
ekielvvigpetplmnglsdalteegilvfgpskaaarles

Timeline for d3lp8a1:

• d3lp8a1 first appeared in SCOPe 2.04
  
• d3lp8a1 appears in SCOPe 2.07