![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
![]() | Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
![]() | Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
![]() | Protein automated matches [226903] (40 species) not a true protein |
![]() | Species Ehrlichia chaffeensis [TaxId:205920] [255934] (1 PDB entry) |
![]() | Domain d3lp8a1: 3lp8 A:1-101 [247483] Other proteins in same PDB: d3lp8a2, d3lp8a3, d3lp8a4 automated match to d1gsoa2 complexed with po4, unx |
PDB Entry: 3lp8 (more details), 2.15 Å
SCOPe Domain Sequences for d3lp8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lp8a1 c.30.1.0 (A:1-101) automated matches {Ehrlichia chaffeensis [TaxId: 205920]} mnvlvigsggrehsmlhhirkstllnklfiapgregmsgladiididinstieviqvckk ekielvvigpetplmnglsdalteegilvfgpskaaarles
Timeline for d3lp8a1: