Lineage for d1cdob1 (1cdo B:1-175,B:325-374)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58601Fold b.35: GroES-like [50128] (2 superfamilies)
  4. 58602Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 58652Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (5 proteins)
  6. 58653Protein Alcohol dehydrogenase [50137] (4 species)
  7. 58654Species Cod (Gadus callarias) [TaxId:8053] [50141] (1 PDB entry)
  8. 58656Domain d1cdob1: 1cdo B:1-175,B:325-374 [24748]
    Other proteins in same PDB: d1cdoa2, d1cdob2

Details for d1cdob1

PDB Entry: 1cdo (more details), 2.05 Å

PDB Description: alcohol dehydrogenase (e.c.1.1.1.1) (ee isozyme) complexed with nicotinamide adenine dinucleotide (nad), and zinc

SCOP Domain Sequences for d1cdob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cdob1 b.35.1.2 (B:1-175,B:325-374) Alcohol dehydrogenase {Cod (Gadus callarias)}
atvgkvikckaavaweankplvieeievdvphaneirikiiatgvchtdlyhlfegkhkd
gfpvvlghegagivesvgpgvtefqpgekviplfisqcgecrfcqspktnqcvkgwanes
pdvmspketrftckgrkvlqflgtstfsqytvvnqiavakidpsapldtvcllgcXkdgv
pkmvkayldkkvkldefithrmplesvndaidlmkhgkcirtvlsl

SCOP Domain Coordinates for d1cdob1:

Click to download the PDB-style file with coordinates for d1cdob1.
(The format of our PDB-style files is described here.)

Timeline for d1cdob1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cdob2