SCOPe 2.05: Domain d3lkzb_: 3lkz B:

Lineage for d3lkzb_ (3lkz B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.25: mRNA cap methylase [88785] (3 proteins)

6. Protein automated matches [190302] (5 species)
   not a true protein

7. Species West Nile virus [TaxId:11082] [187969] (2 PDB entries)

8. Domain d3lkzb_: 3lkz B: [247470]
   automated match to d2px8b_
   complexed with gol, sfg

Details for d3lkzb_

PDB Entry: 3lkz, 2 Å

PDB Description: Structural and functional analyses of a conserved hydrophobic pocket of flavivirus methyltransferase

PDB Compounds: (B:) non-structural protein 5

SCOPe Domain Sequences for d3lkzb_:

Sequence; same for both SEQRES and ATOM records:

>d3lkzb_ c.66.1.25 (B:) automated matches {West Nile virus [TaxId: 11082]}
grtlgevwkerlnqmtkeeftryrkeaiievdrsaakharkegnvtgghpvsrgtaklrw
lverrflepvgkvidlgcgrggwcyymatqkrvqevrgytkggpgheepqlvqsygwniv
tmksgvdvfyrpseccdtllcdigessssaeveehrtirvlemvedwlhrgprefcvkvl
cpympkviekmellqrryggglvrnplsrnsthemywvsrasgnvvhsvnmtsqvllgrm
ekrtwkgpqyeedvnlgsgtra

Timeline for d3lkzb_:

• d3lkzb_ first appeared in SCOPe 2.04
  
• d3lkzb_ appears in SCOPe 2.06
  
• d3lkzb_ appears in the current release, SCOPe 2.08