Lineage for d3lkzb_ (3lkz B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893582Family c.66.1.25: mRNA cap methylase [88785] (4 proteins)
  6. 2893632Protein automated matches [190302] (11 species)
    not a true protein
  7. 2893690Species West Nile virus [TaxId:11082] [187969] (2 PDB entries)
  8. 2893692Domain d3lkzb_: 3lkz B: [247470]
    automated match to d2px8b_
    complexed with gol, sfg

Details for d3lkzb_

PDB Entry: 3lkz (more details), 2 Å

PDB Description: Structural and functional analyses of a conserved hydrophobic pocket of flavivirus methyltransferase
PDB Compounds: (B:) non-structural protein 5

SCOPe Domain Sequences for d3lkzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lkzb_ c.66.1.25 (B:) automated matches {West Nile virus [TaxId: 11082]}
grtlgevwkerlnqmtkeeftryrkeaiievdrsaakharkegnvtgghpvsrgtaklrw
lverrflepvgkvidlgcgrggwcyymatqkrvqevrgytkggpgheepqlvqsygwniv
tmksgvdvfyrpseccdtllcdigessssaeveehrtirvlemvedwlhrgprefcvkvl
cpympkviekmellqrryggglvrnplsrnsthemywvsrasgnvvhsvnmtsqvllgrm
ekrtwkgpqyeedvnlgsgtra

SCOPe Domain Coordinates for d3lkzb_:

Click to download the PDB-style file with coordinates for d3lkzb_.
(The format of our PDB-style files is described here.)

Timeline for d3lkzb_: