Lineage for d1cdoa1 (1cdo A:1-164,A:340-374)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785352Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2785353Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2785485Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 2785506Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 2785515Species Cod (Gadus callarias) [TaxId:8053] [50141] (1 PDB entry)
  8. 2785516Domain d1cdoa1: 1cdo A:1-164,A:340-374 [24747]
    Other proteins in same PDB: d1cdoa2, d1cdob2
    complexed with nad, zn

Details for d1cdoa1

PDB Entry: 1cdo (more details), 2.05 Å

PDB Description: alcohol dehydrogenase (e.c.1.1.1.1) (ee isozyme) complexed with nicotinamide adenine dinucleotide (nad), and zinc
PDB Compounds: (A:) alcohol dehydrogenase

SCOPe Domain Sequences for d1cdoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cdoa1 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]}
atvgkvikckaavaweankplvieeievdvphaneirikiiatgvchtdlyhlfegkhkd
gfpvvlghegagivesvgpgvtefqpgekviplfisqcgecrfcqspktnqcvkgwanes
pdvmspketrftckgrkvlqflgtstfsqytvvnqiavakidpsXvkldefithrmples
vndaidlmkhgkcirtvlsl

SCOPe Domain Coordinates for d1cdoa1:

Click to download the PDB-style file with coordinates for d1cdoa1.
(The format of our PDB-style files is described here.)

Timeline for d1cdoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cdoa2