SCOPe 2.04: Domain d3lgja_: 3lgj A:

Lineage for d3lgja_ (3lgj A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (22 species)
   not a true protein

7. Species Bartonella henselae [TaxId:38323] [255930] (2 PDB entries)

8. Domain d3lgja_: 3lgj A: [247462]
   automated match to d1eqqb_
   complexed with ca

Details for d3lgja_

PDB Entry: 3lgj, 2.5 Å

PDB Description: Crystal structure of single-stranded binding protein (ssb) from Bartonella henselae

PDB Compounds: (A:) Single-stranded DNA-binding protein

SCOPe Domain Sequences for d3lgja_:

Sequence, based on SEQRES records:

>d3lgja_ b.40.4.0 (A:) automated matches {Bartonella henselae [TaxId: 38323]}
gsmlnkvmligylgddpesktmtsgaevvnfrmatfesymnknthqkvektewhsvvvfn
phfakialqylhkgskvyiegklqtrkwqdknghdrytteivlpqykgelhllda

Sequence, based on observed residues (ATOM records):

>d3lgja_ b.40.4.0 (A:) automated matches {Bartonella henselae [TaxId: 38323]}
gsmlnkvmligylgddpesktmtsgaevvnfrmatfektewhsvvvfnphfakialqylh
kgskvyiegklqtrkwytteivlpqykgelhllda

Timeline for d3lgja_:

• d3lgja_ appears in SCOPe 2.05
  
• d3lgja_ appears in the current release, SCOPe 2.07, called d3lgja1