Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.18: ACT-like [55021] (15 families) regulatory domain linked to a wide range of metabolic enzymes |
Family d.58.18.0: automated matches [227175] (1 protein) not a true family |
Protein automated matches [226892] (5 species) not a true protein |
Species Helicobacter pylori [TaxId:85962] [230608] (9 PDB entries) |
Domain d3lghd_: 3lgh D: [247461] Other proteins in same PDB: d3lgha1, d3lghb1 automated match to d2cada2 complexed with mg, ni |
PDB Entry: 3lgh (more details), 2.37 Å
SCOPe Domain Sequences for d3lghd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lghd_ d.58.18.0 (D:) automated matches {Helicobacter pylori [TaxId: 85962]} kiavlvviydhhqrelnqrmidiqhasgthvlctthihmdehncletiilqgnsfeiqrl qleigglrgvkfakltka
Timeline for d3lghd_: