Lineage for d3lghd_ (3lgh D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954059Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 2954274Family d.58.18.0: automated matches [227175] (1 protein)
    not a true family
  6. 2954275Protein automated matches [226892] (5 species)
    not a true protein
  7. 2954299Species Helicobacter pylori [TaxId:85962] [230608] (9 PDB entries)
  8. 2954321Domain d3lghd_: 3lgh D: [247461]
    Other proteins in same PDB: d3lgha1, d3lghb1
    automated match to d2cada2
    complexed with mg, ni

Details for d3lghd_

PDB Entry: 3lgh (more details), 2.37 Å

PDB Description: crystal structure of nikr from helicobacter pylori with variable ni site coordination
PDB Compounds: (D:) Nickel-responsive regulator

SCOPe Domain Sequences for d3lghd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lghd_ d.58.18.0 (D:) automated matches {Helicobacter pylori [TaxId: 85962]}
kiavlvviydhhqrelnqrmidiqhasgthvlctthihmdehncletiilqgnsfeiqrl
qleigglrgvkfakltka

SCOPe Domain Coordinates for d3lghd_:

Click to download the PDB-style file with coordinates for d3lghd_.
(The format of our PDB-style files is described here.)

Timeline for d3lghd_: