Lineage for d3lghb2 (3lgh B:61-147)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1910214Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 1910415Family d.58.18.0: automated matches [227175] (1 protein)
    not a true family
  6. 1910416Protein automated matches [226892] (5 species)
    not a true protein
  7. 1910440Species Helicobacter pylori [TaxId:85962] [230608] (9 PDB entries)
  8. 1910460Domain d3lghb2: 3lgh B:61-147 [247459]
    Other proteins in same PDB: d3lgha1, d3lghb1
    automated match to d2cajb2
    complexed with mg, ni

Details for d3lghb2

PDB Entry: 3lgh (more details), 2.37 Å

PDB Description: crystal structure of nikr from helicobacter pylori with variable ni site coordination
PDB Compounds: (B:) Nickel-responsive regulator

SCOPe Domain Sequences for d3lghb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lghb2 d.58.18.0 (B:61-147) automated matches {Helicobacter pylori [TaxId: 85962]}
deskiavlvviydhhqrelnqrmidiqhasgthvlctthihmdehncletiilqgnsfei
qrlqleigglrgvkfakltkassfeyn

SCOPe Domain Coordinates for d3lghb2:

Click to download the PDB-style file with coordinates for d3lghb2.
(The format of our PDB-style files is described here.)

Timeline for d3lghb2: