SCOPe 2.06: Domain d3lghb1: 3lgh B:9-60

Lineage for d3lghb1 (3lgh B:9-60)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families)
   formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon

5. Family a.43.1.0: automated matches [230594] (1 protein)
   not a true family

6. Protein automated matches [230595] (4 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85962] [230596] (9 PDB entries)

8. Domain d3lghb1: 3lgh B:9-60 [247458]
   Other proteins in same PDB: d3lgha2, d3lghb2, d3lghc_, d3lghd_
   automated match to d2cajb1
   complexed with mg, ni

Details for d3lghb1

PDB Entry: 3lgh, 2.37 Å

PDB Description: crystal structure of nikr from helicobacter pylori with variable ni site coordination

PDB Compounds: (B:) Nickel-responsive regulator

SCOPe Domain Sequences for d3lghb1:

Sequence; same for both SEQRES and ATOM records:

>d3lghb1 a.43.1.0 (B:9-60) automated matches {Helicobacter pylori [TaxId: 85962]}
siirfsvslqqnlldeldnriikngyssrselvrdmireklvednwaednpn

Timeline for d3lghb1:

• d3lghb1 first appeared in SCOPe 2.04
  
• d3lghb1 appears in SCOPe 2.05
  
• d3lghb1 appears in SCOPe 2.07
  
• d3lghb1 appears in the current release, SCOPe 2.08