SCOPe 2.08: Domain d3lgha2: 3lgh A:62-142

Lineage for d3lgha2 (3lgh A:62-142)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (15 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.0: automated matches [227175] (1 protein)
   not a true family

6. Protein automated matches [226892] (5 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85962] [230608] (9 PDB entries)

8. Domain d3lgha2: 3lgh A:62-142 [247457]
   Other proteins in same PDB: d3lgha1, d3lghb1
   automated match to d2cada2
   complexed with mg, ni

Details for d3lgha2

PDB Entry: 3lgh, 2.37 Å

PDB Description: crystal structure of nikr from helicobacter pylori with variable ni site coordination

PDB Compounds: (A:) Nickel-responsive regulator

SCOPe Domain Sequences for d3lgha2:

Sequence; same for both SEQRES and ATOM records:

>d3lgha2 d.58.18.0 (A:62-142) automated matches {Helicobacter pylori [TaxId: 85962]}
eskiavlvviydhhqrelnqrmidiqhasgthvlctthihmdehncletiilqgnsfeiq
rlqleigglrgvkfakltkas

Timeline for d3lgha2:

• d3lgha2 first appeared in SCOPe 2.04
  
• d3lgha2 appears in SCOPe 2.07