Lineage for d3lgha1 (3lgh A:10-59)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712590Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 2712591Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 2712798Family a.43.1.0: automated matches [230594] (1 protein)
    not a true family
  6. 2712799Protein automated matches [230595] (4 species)
    not a true protein
  7. 2712805Species Helicobacter pylori [TaxId:85962] [230596] (9 PDB entries)
  8. 2712824Domain d3lgha1: 3lgh A:10-59 [247456]
    Other proteins in same PDB: d3lgha2, d3lghb2, d3lghc_, d3lghd_
    automated match to d2cada1
    complexed with mg, ni

Details for d3lgha1

PDB Entry: 3lgh (more details), 2.37 Å

PDB Description: crystal structure of nikr from helicobacter pylori with variable ni site coordination
PDB Compounds: (A:) Nickel-responsive regulator

SCOPe Domain Sequences for d3lgha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lgha1 a.43.1.0 (A:10-59) automated matches {Helicobacter pylori [TaxId: 85962]}
iirfsvslqqnlldeldnriikngyssrselvrdmireklvednwaednp

SCOPe Domain Coordinates for d3lgha1:

Click to download the PDB-style file with coordinates for d3lgha1.
(The format of our PDB-style files is described here.)

Timeline for d3lgha1: