| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.43: Ribbon-helix-helix [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) ![]() formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon |
| Family a.43.1.0: automated matches [230594] (1 protein) not a true family |
| Protein automated matches [230595] (4 species) not a true protein |
| Species Helicobacter pylori [TaxId:85962] [230596] (9 PDB entries) |
| Domain d3lgha1: 3lgh A:10-59 [247456] Other proteins in same PDB: d3lgha2, d3lghb2, d3lghc_, d3lghd_ automated match to d2cada1 complexed with mg, ni |
PDB Entry: 3lgh (more details), 2.37 Å
SCOPe Domain Sequences for d3lgha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lgha1 a.43.1.0 (A:10-59) automated matches {Helicobacter pylori [TaxId: 85962]}
iirfsvslqqnlldeldnriikngyssrselvrdmireklvednwaednp
Timeline for d3lgha1:
View in 3DDomains from other chains: (mouse over for more information) d3lghb1, d3lghb2, d3lghc_, d3lghd_ |