SCOPe 2.08: Domain d3lg4a_: 3lg4 A:

Lineage for d3lg4a_ (3lg4 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein automated matches [190514] (12 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [195885] (5 PDB entries)

8. Domain d3lg4a_: 3lg4 A: [247454]
   automated match to d4fgga_
   complexed with 52v, ndp; mutant

Details for d3lg4a_

PDB Entry: 3lg4, 3.15 Å

PDB Description: Staphylococcus aureus V31Y, F92I mutant dihydrofolate reductase complexed with NADPH and 5-[(3S)-3-(5-methoxy-2',6'-dimethylbiphenyl-3-yl)but-1-yn-1-yl]-6-methylpyrimidine-2,4-diamine

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d3lg4a_:

Sequence; same for both SEQRES and ATOM records:

>d3lg4a_ c.71.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
tlsilvahdlqrvigfenqlpwhlpndlkhykklstghtlvmgrktfesigkplpnrrnv
vltsdtsfnvegvdvihsiediyqlpghvfiiggqtlfeemidkvddmyitviegkfrgd
tffppytfedwevassvegkldekntiphtflhlirk

Timeline for d3lg4a_:

• d3lg4a_ first appeared in SCOPe 2.04
  
• d3lg4a_ appears in SCOPe 2.07