![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
![]() | Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
![]() | Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins) |
![]() | Protein automated matches [190514] (12 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:1280] [195885] (5 PDB entries) |
![]() | Domain d3lg4a_: 3lg4 A: [247454] automated match to d4fgga_ complexed with 52v, ndp; mutant |
PDB Entry: 3lg4 (more details), 3.15 Å
SCOPe Domain Sequences for d3lg4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lg4a_ c.71.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]} tlsilvahdlqrvigfenqlpwhlpndlkhykklstghtlvmgrktfesigkplpnrrnv vltsdtsfnvegvdvihsiediyqlpghvfiiggqtlfeemidkvddmyitviegkfrgd tffppytfedwevassvegkldekntiphtflhlirk
Timeline for d3lg4a_: