Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Ehrlichia chaffeensis [TaxId:205920] [255928] (1 PDB entry) |
Domain d3ld9d1: 3ld9 D:1-201 [247449] Other proteins in same PDB: d3ld9a2, d3ld9b2, d3ld9c2, d3ld9d2 automated match to d3hjna_ complexed with edo, so4 |
PDB Entry: 3ld9 (more details), 2.15 Å
SCOPe Domain Sequences for d3ld9d1:
Sequence, based on SEQRES records: (download)
>d3ld9d1 c.37.1.0 (D:1-201) automated matches {Ehrlichia chaffeensis [TaxId: 205920]} mfitfegidgsgkttqshllaeylseiygvnnvvltrepggtllnesvrnllfkaqglds lsellffiamrrehfvkiikpslmqkkivicdrfidstiayqgygqgidcslidqlndlv idvypditfiidvdineslsrsckngyefadmefyyrvrdgfydiakknphrchvitdks etydiddinfvhlevikvlqm
>d3ld9d1 c.37.1.0 (D:1-201) automated matches {Ehrlichia chaffeensis [TaxId: 205920]} mfitfegidgsgkttqshllaeylseiygvnnvvltrepggtllnesvrnllfkaqglds lsellffiamrrehfvkiikpslmqkkivicdrfidstiayqgygqgidcslidqlndlv idvypditfiidvddmefyyrvrdgfydiakknphrchvittydiddinfvhlevikvlq m
Timeline for d3ld9d1: