Lineage for d3ld9c1 (3ld9 C:1-200)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114081Species Ehrlichia chaffeensis [TaxId:205920] [255928] (1 PDB entry)
  8. 2114084Domain d3ld9c1: 3ld9 C:1-200 [247448]
    Other proteins in same PDB: d3ld9a2, d3ld9b2, d3ld9c2, d3ld9d2
    automated match to d3hjna_
    complexed with edo, so4

Details for d3ld9c1

PDB Entry: 3ld9 (more details), 2.15 Å

PDB Description: Crystal structure of thymidylate kinase from Ehrlichia chaffeensis at 2.15A resolution
PDB Compounds: (C:) thymidylate kinase

SCOPe Domain Sequences for d3ld9c1:

Sequence, based on SEQRES records: (download)

>d3ld9c1 c.37.1.0 (C:1-200) automated matches {Ehrlichia chaffeensis [TaxId: 205920]}
mfitfegidgsgkttqshllaeylseiygvnnvvltrepggtllnesvrnllfkaqglds
lsellffiamrrehfvkiikpslmqkkivicdrfidstiayqgygqgidcslidqlndlv
idvypditfiidvdineslsrsckngyefadmefyyrvrdgfydiakknphrchvitdks
etydiddinfvhlevikvlq

Sequence, based on observed residues (ATOM records): (download)

>d3ld9c1 c.37.1.0 (C:1-200) automated matches {Ehrlichia chaffeensis [TaxId: 205920]}
mfitfegidgsgkttqshllaeylseiygvnnvvltrepggtllnesvrnllfkaqglds
lsellffiamrrehfvkiikpslmqkkivicdrfidstiayqgygqgidcslidqlndlv
idvypditfiidvddmefyyrvrdgfydiakknphrchvitfvhlevikvlq

SCOPe Domain Coordinates for d3ld9c1:

Click to download the PDB-style file with coordinates for d3ld9c1.
(The format of our PDB-style files is described here.)

Timeline for d3ld9c1: