SCOPe 2.08: Domain d3ld2b1: 3ld2 B:1-161

Lineage for d3ld2b1 (3ld2 B:1-161)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (49 species)
   not a true protein

7. Species Streptococcus mutans [TaxId:210007] [255927] (1 PDB entry)

8. Domain d3ld2b1: 3ld2 B:1-161 [247443]
   Other proteins in same PDB: d3ld2a2, d3ld2b2, d3ld2d2
   automated match to d2ae6c_
   complexed with coa

Details for d3ld2b1

PDB Entry: 3ld2, 2.5 Å

PDB Description: The Crystal Structure of smu.2055 from Streptococcus mutans UA159

PDB Compounds: (B:) putative acetyltransferase

SCOPe Domain Sequences for d3ld2b1:

Sequence; same for both SEQRES and ATOM records:

>d3ld2b1 d.108.1.0 (B:1-161) automated matches {Streptococcus mutans [TaxId: 210007]}
mkispmllsdieqvvelenktwseqntpvplpvaskdqiiqkfesnthflvakikdkivg
vldysslypfpsgqhivtfgiavaekerrkgigralvqiflnevksdyqkvlihvlssnq
eavlfykklgfdlearltkqfflkgqyvddliysydleaay

Timeline for d3ld2b1:

• d3ld2b1 first appeared in SCOPe 2.04, called d3ld2b_
  
• d3ld2b1 appears in SCOPe 2.07