Lineage for d3lbec_ (3lbe C:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1646047Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1646048Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1646749Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 1646750Protein automated matches [190143] (26 species)
    not a true protein
  7. 1646868Species Streptococcus mutans [TaxId:210007] [255926] (2 PDB entries)
  8. 1646871Domain d3lbec_: 3lbe C: [247440]
    automated match to d4i82a_
    complexed with cl, coa

Details for d3lbec_

PDB Entry: 3lbe (more details), 1.7 Å

PDB Description: The Crystal Structure of smu.793 from Streptococcus mutans UA159 bound to acetyl CoA
PDB Compounds: (C:) Putative uncharacterized protein smu.793

SCOPe Domain Sequences for d3lbec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lbec_ d.38.1.0 (C:) automated matches {Streptococcus mutans [TaxId: 210007]}
hlheirvfenfdmvsfekghvivttevvdkslnyygfahggyiftlcdqisglvsistgf
davtlqssinylksgklgdtllidgrcvhdgrttkvvdvtvtnqlkqevakatftmfvtg
kr

SCOPe Domain Coordinates for d3lbec_:

Click to download the PDB-style file with coordinates for d3lbec_.
(The format of our PDB-style files is described here.)

Timeline for d3lbec_: