SCOPe 2.07: Domain d1e3eb1: 1e3e B:4-167,B:342-376

Lineage for d1e3eb1 (1e3e B:4-167,B:342-376)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (3 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Alcohol dehydrogenase [50137] (9 species)
   contains a Zn-finger subdomain, residues 94-117

7. Species Mouse (Mus musculus), class II [TaxId:10090] [50140] (3 PDB entries)

8. Domain d1e3eb1: 1e3e B:4-167,B:342-376 [24744]
   Other proteins in same PDB: d1e3ea2, d1e3eb2
   complexed with nai, zn

Details for d1e3eb1

PDB Entry: 1e3e, 2.12 Å

PDB Description: mouse class ii alcohol dehydrogenase complex with nadh

PDB Compounds: (B:) alcohol dehydrogenase, class II

SCOPe Domain Sequences for d1e3eb1:

Sequence; same for both SEQRES and ATOM records:

>d1e3eb1 b.35.1.2 (B:4-167,B:342-376) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]}
gkvikckaaiawktgsplcieeievsppkacevriqviatcvcptdinatdpkkkalfpv
vlghecagivesvgpgvtnfkpgdkvipffapqckrcklclspltnlcgklrnfkyptid
qelmedrtsrftckgrsiyhfmgvssfsqytvvseanlarvddeXfdldllvthalpfes
indaidlmkegksirtiltf

Timeline for d1e3eb1:

• d1e3eb1 first appeared (with stable ids) in SCOP 1.55
  
• d1e3eb1 appears in SCOPe 2.06
  
• d1e3eb1 appears in the current release, SCOPe 2.08