![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) ![]() |
![]() | Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
![]() | Protein automated matches [190143] (42 species) not a true protein |
![]() | Species Streptococcus mutans [TaxId:210007] [255926] (2 PDB entries) |
![]() | Domain d3lbeb_: 3lbe B: [247439] automated match to d4i82a_ complexed with cl, coa |
PDB Entry: 3lbe (more details), 1.7 Å
SCOPe Domain Sequences for d3lbeb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lbeb_ d.38.1.0 (B:) automated matches {Streptococcus mutans [TaxId: 210007]} nhlheirvfenfdmvsfekghvivttevvdkslnyygfahggyiftlcdqisglvsistg fdavtlqssinylksgklgdtllidgrcvhdgrttkvvdvtvtnqlkqevakatftmfvt gkrk
Timeline for d3lbeb_: