Lineage for d3lbeb_ (3lbe B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944312Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2944313Protein automated matches [190143] (42 species)
    not a true protein
  7. 2944625Species Streptococcus mutans [TaxId:210007] [255926] (2 PDB entries)
  8. 2944627Domain d3lbeb_: 3lbe B: [247439]
    automated match to d4i82a_
    complexed with cl, coa

Details for d3lbeb_

PDB Entry: 3lbe (more details), 1.7 Å

PDB Description: The Crystal Structure of smu.793 from Streptococcus mutans UA159 bound to acetyl CoA
PDB Compounds: (B:) Putative uncharacterized protein smu.793

SCOPe Domain Sequences for d3lbeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lbeb_ d.38.1.0 (B:) automated matches {Streptococcus mutans [TaxId: 210007]}
nhlheirvfenfdmvsfekghvivttevvdkslnyygfahggyiftlcdqisglvsistg
fdavtlqssinylksgklgdtllidgrcvhdgrttkvvdvtvtnqlkqevakatftmfvt
gkrk

SCOPe Domain Coordinates for d3lbeb_:

Click to download the PDB-style file with coordinates for d3lbeb_.
(The format of our PDB-style files is described here.)

Timeline for d3lbeb_: