Lineage for d3lbba_ (3lbb A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550604Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2550605Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2551373Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2551374Protein automated matches [190143] (41 species)
    not a true protein
  7. 2551678Species Streptococcus mutans [TaxId:210007] [255926] (2 PDB entries)
  8. 2551683Domain d3lbba_: 3lbb A: [247436]
    automated match to d4i82a_
    complexed with cl, so4

Details for d3lbba_

PDB Entry: 3lbb (more details), 2.1 Å

PDB Description: The Crystal Structure of smu.793 from Streptococcus mutans UA159
PDB Compounds: (A:) Putative uncharacterized protein smu.793

SCOPe Domain Sequences for d3lbba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lbba_ d.38.1.0 (A:) automated matches {Streptococcus mutans [TaxId: 210007]}
nhlheirvfenfdmvsfekghvivttevvdkslnyygfahggyiftlcdqisglvsistg
fdavtlqssinylksgklgdtllidgrcvhdgrttkvvdvtvtnqlkqevakatftmfvt
gkrk

SCOPe Domain Coordinates for d3lbba_:

Click to download the PDB-style file with coordinates for d3lbba_.
(The format of our PDB-style files is described here.)

Timeline for d3lbba_: