SCOPe 2.08: Domain d3lbba_: 3lbb A:

Lineage for d3lbba_ (3lbb A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families)

5. Family d.38.1.0: automated matches [191325] (1 protein)
   not a true family

6. Protein automated matches [190143] (42 species)
   not a true protein

7. Species Streptococcus mutans [TaxId:210007] [255926] (2 PDB entries)

8. Domain d3lbba_: 3lbb A: [247436]
   automated match to d4i82a_
   complexed with cl, so4

Details for d3lbba_

PDB Entry: 3lbb, 2.1 Å

PDB Description: The Crystal Structure of smu.793 from Streptococcus mutans UA159

PDB Compounds: (A:) Putative uncharacterized protein smu.793

SCOPe Domain Sequences for d3lbba_:

Sequence; same for both SEQRES and ATOM records:

>d3lbba_ d.38.1.0 (A:) automated matches {Streptococcus mutans [TaxId: 210007]}
nhlheirvfenfdmvsfekghvivttevvdkslnyygfahggyiftlcdqisglvsistg
fdavtlqssinylksgklgdtllidgrcvhdgrttkvvdvtvtnqlkqevakatftmfvt
gkrk

Timeline for d3lbba_:

• d3lbba_ first appeared in SCOPe 2.04
  
• d3lbba_ appears in SCOPe 2.07