Class a: All alpha proteins [46456] (286 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
Protein Interleukin-13 (IL-13) [63532] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [63533] (10 PDB entries) |
Domain d3lb6a_: 3lb6 A: [247433] automated match to d1ik0a_ complexed with ca, nag |
PDB Entry: 3lb6 (more details), 3.05 Å
SCOPe Domain Sequences for d3lb6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lb6a_ a.26.1.2 (A:) Interleukin-13 (IL-13) {Human (Homo sapiens) [TaxId: 9606]} ppstalrelieelvnitqnqkaplcngsmvwsinltagmycaaleslinvsgcsaiektq rmlsgfcphkvsagqfsslhvrdtkievaqfvkdlllhlkklfregrfn
Timeline for d3lb6a_: