Lineage for d3lb6a_ (3lb6 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1486907Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1486908Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1486997Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 1487016Protein Interleukin-13 (IL-13) [63532] (1 species)
  7. 1487017Species Human (Homo sapiens) [TaxId:9606] [63533] (9 PDB entries)
  8. 1487022Domain d3lb6a_: 3lb6 A: [247433]
    automated match to d1ik0a_
    complexed with ca, nag

Details for d3lb6a_

PDB Entry: 3lb6 (more details), 3.05 Å

PDB Description: the structure of il-13 in complex with il-13ralpha2
PDB Compounds: (A:) interleukin-13

SCOPe Domain Sequences for d3lb6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lb6a_ a.26.1.2 (A:) Interleukin-13 (IL-13) {Human (Homo sapiens) [TaxId: 9606]}
ppstalrelieelvnitqnqkaplcngsmvwsinltagmycaaleslinvsgcsaiektq
rmlsgfcphkvsagqfsslhvrdtkievaqfvkdlllhlkklfregrfn

SCOPe Domain Coordinates for d3lb6a_:

Click to download the PDB-style file with coordinates for d3lb6a_.
(The format of our PDB-style files is described here.)

Timeline for d3lb6a_: