SCOPe 2.08: Domain d3lb6a_: 3lb6 A:

Lineage for d3lb6a_ (3lb6 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein Interleukin-13 (IL-13) [63532] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63533] (13 PDB entries)

8. Domain d3lb6a_: 3lb6 A: [247433]
   automated match to d1ik0a_
   complexed with ca, nag

Details for d3lb6a_

PDB Entry: 3lb6, 3.05 Å

PDB Description: the structure of il-13 in complex with il-13ralpha2

PDB Compounds: (A:) interleukin-13

SCOPe Domain Sequences for d3lb6a_:

Sequence; same for both SEQRES and ATOM records:

>d3lb6a_ a.26.1.2 (A:) Interleukin-13 (IL-13) {Human (Homo sapiens) [TaxId: 9606]}
ppstalrelieelvnitqnqkaplcngsmvwsinltagmycaaleslinvsgcsaiektq
rmlsgfcphkvsagqfsslhvrdtkievaqfvkdlllhlkklfregrfn

Timeline for d3lb6a_:

• d3lb6a_ first appeared in SCOPe 2.04
  
• d3lb6a_ appears in SCOPe 2.07