Lineage for d3l9kd_ (3l9k D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2971065Superfamily d.110.7: Roadblock/LC7 domain [103196] (2 families) (S)
    alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices
  5. 2971066Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
    Pfam PF03259
  6. 2971097Protein automated matches [190414] (3 species)
    not a true protein
  7. 2971098Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [189327] (2 PDB entries)
  8. 2971106Domain d3l9kd_: 3l9k D: [247430]
    automated match to d3l7hb_

Details for d3l9kd_

PDB Entry: 3l9k (more details), 3 Å

PDB Description: Insights into dynein assembly from a dynein intermediate chain-light chain roadblock structure
PDB Compounds: (D:) RE64145p

SCOPe Domain Sequences for d3l9kd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l9kd_ d.110.7.1 (D:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
qeveetlkriqshkgvvgtivvnnegipvkstldntttvqyaglmsqladkarsvvrdld
psndmtflrvrskkheimvapdkdfiliviqnptd

SCOPe Domain Coordinates for d3l9kd_:

Click to download the PDB-style file with coordinates for d3l9kd_.
(The format of our PDB-style files is described here.)

Timeline for d3l9kd_: