Lineage for d3l9kb_ (3l9k B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2210472Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2211247Superfamily d.110.7: Roadblock/LC7 domain [103196] (1 family) (S)
    alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices
  5. 2211248Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
    Pfam PF03259
  6. 2211279Protein automated matches [190414] (3 species)
    not a true protein
  7. 2211280Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [189327] (2 PDB entries)
  8. 2211286Domain d3l9kb_: 3l9k B: [247428]
    automated match to d3l7hb_

Details for d3l9kb_

PDB Entry: 3l9k (more details), 3 Å

PDB Description: Insights into dynein assembly from a dynein intermediate chain-light chain roadblock structure
PDB Compounds: (B:) RE64145p

SCOPe Domain Sequences for d3l9kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l9kb_ d.110.7.1 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
qeveetlkriqshkgvvgtivvnnegipvkstldntttvqyaglmsqladkarsvvrdld
psndmtflrvrskkheimvapdkdfiliviqnptd

SCOPe Domain Coordinates for d3l9kb_:

Click to download the PDB-style file with coordinates for d3l9kb_.
(The format of our PDB-style files is described here.)

Timeline for d3l9kb_: