Lineage for d1e3ib1 (1e3i B:4-174,B:325-376)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 109690Fold b.35: GroES-like [50128] (2 superfamilies)
  4. 109691Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 109741Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (5 proteins)
  6. 109742Protein Alcohol dehydrogenase [50137] (4 species)
  7. 109834Species Mouse (Mus musculus), class II [TaxId:10090] [50140] (3 PDB entries)
  8. 109836Domain d1e3ib1: 1e3i B:4-174,B:325-376 [24742]
    Other proteins in same PDB: d1e3ia2, d1e3ib2

Details for d1e3ib1

PDB Entry: 1e3i (more details), 2.08 Å

PDB Description: mouse class ii alcohol dehydrogenase complex with nadh and inhibitor

SCOP Domain Sequences for d1e3ib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e3ib1 b.35.1.2 (B:4-174,B:325-376) Alcohol dehydrogenase {Mouse (Mus musculus), class II}
gkvikckaaiawktgsplcieeievsppkacevriqviatcvcptdinatdpkkkalfpv
vlghecagivesvgpgvtnfkpgdkvipffapqckrcklclspltnlcgklrnfkyptid
qelmedrtsrftckgrsiyhfmgvssfsqytvvseanlarvddeanlervcXksvdsvpn
lvsdyknkkfdldllvthalpfesindaidlmkegksirtiltf

SCOP Domain Coordinates for d1e3ib1:

Click to download the PDB-style file with coordinates for d1e3ib1.
(The format of our PDB-style files is described here.)

Timeline for d1e3ib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e3ib2