SCOPe 2.05: Domain d3l8qa2: 3l8q A:173-338

Lineage for d3l8qa2 (3l8q A:173-338)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.2: Cellulose-binding domain family III [49390] (9 proteins)
   Pfam PF00963

6. Protein Cellulosomal scaffoldin adaptor protein B, ScaB [110073] (1 species)

7. Species Acetivibrio cellulolyticus [TaxId:35830] [110074] (8 PDB entries)
   Uniprot Q7WYN3 29-199

8. Domain d3l8qa2: 3l8q A:173-338 [247418]
   automated match to d3f2la_
   complexed with edo, hez, pdo

Details for d3l8qa2

PDB Entry: 3l8q, 1.57 Å

PDB Description: structure analysis of the type ii cohesin dyad from the adaptor scaa scaffoldin of acetivibrio cellulolyticus

PDB Compounds: (A:) Cellulosomal scaffoldin adaptor protein B

SCOPe Domain Sequences for d3l8qa2:

Sequence; same for both SEQRES and ATOM records:

>d3l8qa2 b.2.2.2 (A:173-338) Cellulosomal scaffoldin adaptor protein B, ScaB {Acetivibrio cellulolyticus [TaxId: 35830]}
syitmgydknaaevgeiikatvkinkitnfsgyqvnikydptvlqavnpktgvaytnssl
ptsgellvsedygpivqgvhkisegilnlsrsytalevyrasespeetgtlavvgfkvlq
kkattvvfedsetmpngitgttlfnwygnriqsgyfviqpgeinsa

Timeline for d3l8qa2:

• d3l8qa2 first appeared in SCOPe 2.04
  
• d3l8qa2 appears in SCOPe 2.06
  
• d3l8qa2 appears in the current release, SCOPe 2.08