Lineage for d3l87a_ (3l87 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2606866Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 2606867Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 2606868Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
    automatically mapped to Pfam PF01327
  6. 2606994Protein automated matches [190200] (10 species)
    not a true protein
  7. 2607048Species Streptococcus mutans [TaxId:210007] [255922] (1 PDB entry)
  8. 2607049Domain d3l87a_: 3l87 A: [247414]
    automated match to d2os3a_
    complexed with fe

Details for d3l87a_

PDB Entry: 3l87 (more details), 2 Å

PDB Description: The Crystal Structure of smu.143c from Streptococcus mutans UA159
PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d3l87a_:

Sequence, based on SEQRES records: (download)

>d3l87a_ d.167.1.1 (A:) automated matches {Streptococcus mutans [TaxId: 210007]}
msaiktitkashlidmndiireghptlravaqdvtfplneddiilgekmlqflknsqdpv
taekmelrggvglaapqldiskriiavlipnpedkdgnppkeayalkevmynpriiahsv
qdaaladgegclsvdrvvegyvirhsrvtieyydknsdkkklklkgyqsivvqheidhtn
gimffdrineknpfeikeglllie

Sequence, based on observed residues (ATOM records): (download)

>d3l87a_ d.167.1.1 (A:) automated matches {Streptococcus mutans [TaxId: 210007]}
msaiktitkashlidmndiireghptlravaqdvtfplneddiilgekmlqflknsqdpv
taekmelrggvglaapqldiskriiavlipnpedppkeayalkevmynpriiahsvqdaa
ladgegclsvdrvvegyvirhsrvtieyydknsdkkklklkgyqsivvqheidhtngimf
fdrineknpfeikeglllie

SCOPe Domain Coordinates for d3l87a_:

Click to download the PDB-style file with coordinates for d3l87a_.
(The format of our PDB-style files is described here.)

Timeline for d3l87a_: