Class b: All beta proteins [48724] (178 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.7: Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor [49447] (2 families) duplication: one domain of this fold is inserted into another domain of the same fold |
Family b.2.7.0: automated matches [195107] (1 protein) not a true family |
Protein automated matches [195108] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255919] (1 PDB entry) |
Domain d3l81a_: 3l81 A: [247413] automated match to d1h6ea_ complexed with gol |
PDB Entry: 3l81 (more details), 1.6 Å
SCOPe Domain Sequences for d3l81a_:
Sequence, based on SEQRES records: (download)
>d3l81a_ b.2.7.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} nevfldvverlsvliasngsllkvdvqgeirlksflpsgsemriglteefsvgkselrgy gpgirvdevsfhssvnldefeshrilrlqppqgeltvmryqlsddlpsplpfrlfpsvqw drgsgrlqvylklrcdllsksqalnvrlhlplprgvvslsqelsspeqkaelaegalrwd lprvqggsqlsglfqmdvpgppgppshglstsasplglgpaslsfelprhtcsglqvrfl rlafrpsgnanphkwvrhlshsdayviri
>d3l81a_ b.2.7.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} nevfldvverlsvliasngsllkvdvqgeirlksflpsgsemriglteefsvgkselrgy gpgirvdevsfhssvnldefeshrilrlqppqgeltvmryqlsddlpsplpfrlfpsvqw drgsgrlqvylklrcdllsksqalnvrlhlplprgvvslsqelsspeqkaelaegalrwd lprvqggsqlsglfqmdvpgppglglgpaslsfelprhtcsglqvrflrlafphkwvrhl shsdayviri
Timeline for d3l81a_: