Lineage for d3l81a_ (3l81 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2768498Superfamily b.2.7: Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor [49447] (2 families) (S)
    duplication: one domain of this fold is inserted into another domain of the same fold
  5. 2768510Family b.2.7.0: automated matches [195107] (1 protein)
    not a true family
  6. 2768511Protein automated matches [195108] (2 species)
    not a true protein
  7. 2768512Species Human (Homo sapiens) [TaxId:9606] [255919] (1 PDB entry)
  8. 2768513Domain d3l81a_: 3l81 A: [247413]
    automated match to d1h6ea_
    complexed with gol

Details for d3l81a_

PDB Entry: 3l81 (more details), 1.6 Å

PDB Description: crystal structure of adaptor protein complex 4 (ap-4) mu4 subunit c- terminal domain, in complex with a sorting peptide from the amyloid precursor protein (app)
PDB Compounds: (A:) AP-4 complex subunit mu-1

SCOPe Domain Sequences for d3l81a_:

Sequence, based on SEQRES records: (download)

>d3l81a_ b.2.7.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nevfldvverlsvliasngsllkvdvqgeirlksflpsgsemriglteefsvgkselrgy
gpgirvdevsfhssvnldefeshrilrlqppqgeltvmryqlsddlpsplpfrlfpsvqw
drgsgrlqvylklrcdllsksqalnvrlhlplprgvvslsqelsspeqkaelaegalrwd
lprvqggsqlsglfqmdvpgppgppshglstsasplglgpaslsfelprhtcsglqvrfl
rlafrpsgnanphkwvrhlshsdayviri

Sequence, based on observed residues (ATOM records): (download)

>d3l81a_ b.2.7.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nevfldvverlsvliasngsllkvdvqgeirlksflpsgsemriglteefsvgkselrgy
gpgirvdevsfhssvnldefeshrilrlqppqgeltvmryqlsddlpsplpfrlfpsvqw
drgsgrlqvylklrcdllsksqalnvrlhlplprgvvslsqelsspeqkaelaegalrwd
lprvqggsqlsglfqmdvpgppglglgpaslsfelprhtcsglqvrflrlafphkwvrhl
shsdayviri

SCOPe Domain Coordinates for d3l81a_:

Click to download the PDB-style file with coordinates for d3l81a_.
(The format of our PDB-style files is described here.)

Timeline for d3l81a_: