Lineage for d1agnd1 (1agn D:1-174,D:325-374)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 109690Fold b.35: GroES-like [50128] (2 superfamilies)
  4. 109691Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 109741Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (5 proteins)
  6. 109742Protein Alcohol dehydrogenase [50137] (4 species)
  7. 109801Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (13 PDB entries)
  8. 109831Domain d1agnd1: 1agn D:1-174,D:325-374 [24740]
    Other proteins in same PDB: d1agna2, d1agnb2, d1agnc2, d1agnd2

Details for d1agnd1

PDB Entry: 1agn (more details), 3 Å

PDB Description: x-ray structure of human sigma alcohol dehydrogenase

SCOP Domain Sequences for d1agnd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1agnd1 b.35.1.2 (D:1-174,D:325-374) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes}
gtagkvikckaavlweqkqpfsieeievappktkevrikilatgicrtddhvikgtmvsk
fpvivgheatgivesigegvttvkpgdkviplflpqcrecnacrnpdgnlcirsditgrg
vladgttrftckgkpvhhfmntstfteytvvdessvakiddaappekvcligcXrddvpk
lvteflakkfdldqlithvlpfkkisegfellnsgqsirtvltf

SCOP Domain Coordinates for d1agnd1:

Click to download the PDB-style file with coordinates for d1agnd1.
(The format of our PDB-style files is described here.)

Timeline for d1agnd1: