SCOPe 2.06: Domain d1agnb1: 1agn B:1-162,B:339-374

Lineage for d1agnb1 (1agn B:1-162,B:339-374)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (3 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Alcohol dehydrogenase [50137] (9 species)
   contains a Zn-finger subdomain, residues 94-117

7. Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (24 PDB entries)
   Uniprot P00326 ! Uniprot P00325 ! Uniprot P07327

8. Domain d1agnb1: 1agn B:1-162,B:339-374 [24738]
   Other proteins in same PDB: d1agna2, d1agnb2, d1agnc2, d1agnd2
   sigma isozyme
   complexed with act, nad, zn

Details for d1agnb1

PDB Entry: 1agn, 3 Å

PDB Description: x-ray structure of human sigma alcohol dehydrogenase

PDB Compounds: (B:) human sigma alcohol dehydrogenase

SCOPe Domain Sequences for d1agnb1:

Sequence; same for both SEQRES and ATOM records:

>d1agnb1 b.35.1.2 (B:1-162,B:339-374) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}
gtagkvikckaavlweqkqpfsieeievappktkevrikilatgicrtddhvikgtmvsk
fpvivgheatgivesigegvttvkpgdkviplflpqcrecnacrnpdgnlcirsditgrg
vladgttrftckgkpvhhfmntstfteytvvdessvakiddXkfdldqlithvlpfkkis
egfellnsgqsirtvltf

Timeline for d1agnb1:

• d1agnb1 first appeared (with stable ids) in SCOP 1.55
  
• d1agnb1 appears in SCOPe 2.05
  
• d1agnb1 appears in SCOPe 2.07
  
• d1agnb1 appears in the current release, SCOPe 2.08