Lineage for d1agnb1 (1agn B:1-174,B:325-374)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 165795Fold b.35: GroES-like [50128] (2 superfamilies)
  4. 165796Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 165846Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (5 proteins)
  6. 165847Protein Alcohol dehydrogenase [50137] (4 species)
  7. 165906Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (16 PDB entries)
  8. 165940Domain d1agnb1: 1agn B:1-174,B:325-374 [24738]
    Other proteins in same PDB: d1agna2, d1agnb2, d1agnc2, d1agnd2

Details for d1agnb1

PDB Entry: 1agn (more details), 3 Å

PDB Description: x-ray structure of human sigma alcohol dehydrogenase

SCOP Domain Sequences for d1agnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1agnb1 b.35.1.2 (B:1-174,B:325-374) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes}
gtagkvikckaavlweqkqpfsieeievappktkevrikilatgicrtddhvikgtmvsk
fpvivgheatgivesigegvttvkpgdkviplflpqcrecnacrnpdgnlcirsditgrg
vladgttrftckgkpvhhfmntstfteytvvdessvakiddaappekvcligcXrddvpk
lvteflakkfdldqlithvlpfkkisegfellnsgqsirtvltf

SCOP Domain Coordinates for d1agnb1:

Click to download the PDB-style file with coordinates for d1agnb1.
(The format of our PDB-style files is described here.)

Timeline for d1agnb1: