Lineage for d3l72n2 (3l72 N:234-444)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2237726Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 2237727Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 2238011Family d.185.1.0: automated matches [232765] (1 protein)
    not a true family
  6. 2238012Protein automated matches [232766] (2 species)
    not a true protein
  7. 2238013Species Chicken (Gallus gallus) [TaxId:9031] [232768] (8 PDB entries)
  8. 2238074Domain d3l72n2: 3l72 N:234-444 [247377]
    Other proteins in same PDB: d3l72c1, d3l72c2, d3l72d1, d3l72d2, d3l72e1, d3l72e2, d3l72f_, d3l72g_, d3l72h_, d3l72j_, d3l72p1, d3l72p2, d3l72q1, d3l72q2, d3l72r1, d3l72r2, d3l72s_, d3l72t_, d3l72u_, d3l72w_
    automated match to d3l71a2
    complexed with bog, cdl, fes, gol, hec, hem, ikr, pee, uq

Details for d3l72n2

PDB Entry: 3l72 (more details), 3.06 Å

PDB Description: Chicken cytochrome BC1 complex with kresoxym-I-dimethyl bound
PDB Compounds: (N:) Mitochondrial ubiquinol-cytochrome-c reductase complex core protein i

SCOPe Domain Sequences for d3l72n2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l72n2 d.185.1.0 (N:234-444) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
crftgseirarddalpvahvalavegpgwadpdnvvlhvanaiigrydrtfgggkhlssr
laalavehklchsfqtfntsysdtglfgfhfvadplsiddmmfcaqgewmrlctsttese
vkraknhlrsamvaqldgttpvcetigshllnygrrisleewdsrisavdarmvrdvcsk
yiydkcpalaavgpieqlldynrirsgmywi

SCOPe Domain Coordinates for d3l72n2:

Click to download the PDB-style file with coordinates for d3l72n2.
(The format of our PDB-style files is described here.)

Timeline for d3l72n2: