Lineage for d3l72f_ (3l72 F:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1959070Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 1959071Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) (S)
    location - matrix side of the bc1 complex
    automatically mapped to Pfam PF02271
  5. 1959072Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins)
    probably important for the complex assembly, caps the matrix face of cytochrome b
  6. 1959102Protein automated matches [190325] (4 species)
    not a true protein
  7. 1959111Species Chicken (Gallus gallus) [TaxId:9031] [189228] (8 PDB entries)
  8. 1959126Domain d3l72f_: 3l72 F: [247372]
    Other proteins in same PDB: d3l72a1, d3l72a2, d3l72b1, d3l72b2, d3l72c1, d3l72c2, d3l72d1, d3l72d2, d3l72e1, d3l72e2, d3l72g_, d3l72h_, d3l72j_, d3l72n1, d3l72n2, d3l72o1, d3l72o2, d3l72p1, d3l72p2, d3l72q1, d3l72q2, d3l72r1, d3l72r2, d3l72t_, d3l72u_, d3l72w_
    automated match to d1l0lf_
    complexed with bog, cdl, fes, gol, hec, hem, ikr, pee, uq

Details for d3l72f_

PDB Entry: 3l72 (more details), 3.06 Å

PDB Description: chicken cytochrome bc1 complex with kresoxim-i-dimethyl bound
PDB Compounds: (F:) Mitochondrial ubiquinol-cytochrome c reductase 14 kda protein

SCOPe Domain Sequences for d3l72f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l72f_ f.27.1.1 (F:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
grlmdrirkwyynaagfnkyglmrddtlyedddvkealkrlpedlynermfrikraldls
lkhrilpkeqwvkyeedkpylepylkevirerlereawnkk

SCOPe Domain Coordinates for d3l72f_:

Click to download the PDB-style file with coordinates for d3l72f_.
(The format of our PDB-style files is described here.)

Timeline for d3l72f_: