Lineage for d3l6yc_ (3l6y C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006908Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2006909Protein automated matches [190220] (14 species)
    not a true protein
  7. 2006934Species Human (Homo sapiens) [TaxId:9606] [189070] (40 PDB entries)
  8. 2006962Domain d3l6yc_: 3l6y C: [247362]
    automated match to d1xm9a1

Details for d3l6yc_

PDB Entry: 3l6y (more details), 3 Å

PDB Description: crystal structure of p120 catenin in complex with e-cadherin
PDB Compounds: (C:) Catenin delta-1

SCOPe Domain Sequences for d3l6yc_:

Sequence, based on SEQRES records: (download)

>d3l6yc_ a.118.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pppnwrqpelpeviamlgfrldavksnaaaylqhlcyrndkvktdvrklkgipvlvglld
hpkkevhlgacgalknisfgrdqdnkiaikncdgvpalvrllrkardmdltevitgtlwn
lsshdsikmeivdhalhaltdeviiphsgwerepnedckprhiewesvltntagclrnvs
sersearrklrecdglvdalifivqaeigqkdsdsklvencvcllrnlsyqvhreipqae
ryqeaapnvanntgtspargyellfqpevvriyisllkesktpaileasagaiqnlcagr
wtygryirsalrqekalsaiadlltnehervvkaasgalrnlavdarnkeligkhaipnl
vknlpggqqnsswnfsedtvisilntineviaenleaakklretqgieklvlinksgnrs
ekevraaalvlqti

Sequence, based on observed residues (ATOM records): (download)

>d3l6yc_ a.118.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pppnwrqpelpeviamlgfrldavksnaaaylqhlcyrndkvktdvrklkgipvlvglld
hpkkevhlgacgalknisfgrdqdnkiaikncdgvpalvrllrkardmdltevitgtlwn
lsshdsikmeivdhalhaltdeviiphsgwererhiewesvltntagclrnvssersear
rklrecdglvdalifivqaeigqkdsdsklvencvcllrnlsyqvhreipqaerspargy
ellfqpevvriyisllkesktpaileasagaiqnlcagrwtygryirsalrqekalsaia
dlltnehervvkaasgalrnlavdarnkeligkhaipnlvknlfsedtvisilntinevi
asekevraaalvlqti

SCOPe Domain Coordinates for d3l6yc_:

Click to download the PDB-style file with coordinates for d3l6yc_.
(The format of our PDB-style files is described here.)

Timeline for d3l6yc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3l6ye_