Lineage for d3l6xa_ (3l6x A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006908Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2006909Protein automated matches [190220] (14 species)
    not a true protein
  7. 2006934Species Human (Homo sapiens) [TaxId:9606] [189070] (40 PDB entries)
  8. 2006945Domain d3l6xa_: 3l6x A: [247361]
    automated match to d1xm9a1
    complexed with so4

Details for d3l6xa_

PDB Entry: 3l6x (more details), 2.4 Å

PDB Description: crystal structure of p120 catenin in complex with e-cadherin
PDB Compounds: (A:) Catenin delta-1

SCOPe Domain Sequences for d3l6xa_:

Sequence, based on SEQRES records: (download)

>d3l6xa_ a.118.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ppppnwrqpelpeviamlgfrldavksnaaaylqhlcyrndkvktdvrklkgipvlvgll
dhpkkevhlgacgalknisfgrdqdnkiaikncdgvpalvrllrkardmdltevitgtlw
nlsshdsikmeivdhalhaltdeviiphsgwerepnedckprhiewesvltntagclrnv
ssersearrklrecdglvdalifivqaeigqkdsdsklvencvcllrnlsyqvhreipqa
eryqeaapnvanntgtspargyellfqpevvriyisllkesktpaileasagaiqnlcag
rwtygryirsalrqekalsaiadlltnehervvkaasgalrnlavdarnkeligkhaipn
lvknlpggqqnsswnfsedtvisilntineviaenleaakklretqgieklvlinksgnr
sekevraaalvlqtiwgykelrkplekegwkksdfqvn

Sequence, based on observed residues (ATOM records): (download)

>d3l6xa_ a.118.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ppppnwrqpelpeviamlgfrldavksnaaaylqhlcyrndkvktdvrklkgipvlvgll
dhpkkevhlgacgalknisfgrdqdnkiaikncdgvpalvrllrkardmdltevitgtlw
nlsshdsikmeivdhalhaltdeviiphsgwehiewesvltntagclrnvssersearrk
lrecdglvdalifivqaeigqkdsdsklvencvcllrnlsyqvhreipqaerspargyel
lfqpevvriyisllkesktpaileasagaiqnlcagrwtygryirsalrqekalsaiadl
ltnehervvkaasgalrnlavdarnkeligkhaipnlvknlpggqqnsswnfsedtvisi
lntineviaenleaakklretqgieklvlinksgnrsekevraaalvlqtiwgykelrkp
lekegwkksdfqvn

SCOPe Domain Coordinates for d3l6xa_:

Click to download the PDB-style file with coordinates for d3l6xa_.
(The format of our PDB-style files is described here.)

Timeline for d3l6xa_: