Lineage for d3hudb1 (3hud B:1-174,B:325-374)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58601Fold b.35: GroES-like [50128] (2 superfamilies)
  4. 58602Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 58652Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (5 proteins)
  6. 58653Protein Alcohol dehydrogenase [50137] (4 species)
  7. 58712Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (13 PDB entries)
  8. 58740Domain d3hudb1: 3hud B:1-174,B:325-374 [24736]
    Other proteins in same PDB: d3huda2, d3hudb2

Details for d3hudb1

PDB Entry: 3hud (more details), 3.2 Å

PDB Description: the structure of human beta 1 beta 1 alcohol dehydrogenase: catalytic effects of non-active-site substitutions

SCOP Domain Sequences for d3hudb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hudb1 b.35.1.2 (B:1-174,B:325-374) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes}
stagkvikckaavlwevkkpfsiedvevappkayevrikmvavgicrtddhvvsgnlvtp
lpvilgheaagivesvgegvttvkpgdkviplftpqcgkcrvcknpesnyclkndlgnpr
gtlqdgtrrftcrgkpihhflgtstfsqytvvdenavakidaasplekvcligcXkegip
klvadfmakkfsldalithvlpfekinegfdllhsgksirtvltf

SCOP Domain Coordinates for d3hudb1:

Click to download the PDB-style file with coordinates for d3hudb1.
(The format of our PDB-style files is described here.)

Timeline for d3hudb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hudb2