SCOPe 2.04: Domain d3l6ua_: 3l6u A:

Lineage for d3l6ua_ (3l6u A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (49 species)
   not a true protein

7. Species Exiguobacterium sibiricum [TaxId:262543] [255918] (1 PDB entry)

8. Domain d3l6ua_: 3l6u A: [247359]
   automated match to d2gx6a_
   complexed with so4

Details for d3l6ua_

PDB Entry: 3l6u, 1.9 Å

PDB Description: crystal structure of abc-type sugar transport system, periplasmic component from exiguobacterium sibiricum

PDB Compounds: (A:) abc-type sugar transport system periplasmic component

SCOPe Domain Sequences for d3l6ua_:

Sequence; same for both SEQRES and ATOM records:

>d3l6ua_ c.93.1.0 (A:) automated matches {Exiguobacterium sibiricum [TaxId: 262543]}
nivgftivndkhefaqrlinafkaeakankyealvatsqnsrisereqilefvhlkvdai
fittlddvyigsaieeakkagipvfaidrmirsdavvssitsnnqmigeqlasyikneli
kqtgrstgriveitgtanvyttnerhrgflkgieneptlsivdsvsgnydpvtservmrq
vidsgipfdavychnddiamgvlealkkakisgkivvgidgnraileavdmksmdatvvq
saeemmkvafsalklhtknkkipdrfytysylyd

Timeline for d3l6ua_:

• d3l6ua_ is new in SCOPe 2.04-stable
  
• d3l6ua_ appears in SCOPe 2.05
  
• d3l6ua_ appears in the current release, SCOPe 2.08