Lineage for d3l5qb_ (3l5q B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1934574Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1936395Protein automated matches [190144] (7 species)
    not a true protein
  7. 1936416Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (39 PDB entries)
  8. 1936651Domain d3l5qb_: 3l5q B: [247340]
    Other proteins in same PDB: d3l5q1_, d3l5q2_, d3l5q3_, d3l5q4_, d3l5qk_, d3l5ql_, d3l5qm_, d3l5qn_, d3l5qo_, d3l5qp_, d3l5qq_, d3l5qr_, d3l5qw_, d3l5qx_, d3l5qy_, d3l5qz_

Details for d3l5qb_

PDB Entry: 3l5q (more details), 3 Å

PDB Description: Proteasome Activator Complex
PDB Compounds: (B:) Proteasome component PRE3

SCOPe Domain Sequences for d3l5qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l5qb_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
asimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivq
yhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvh
klpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvlta
agverlifypdeyeql

SCOPe Domain Coordinates for d3l5qb_:

Click to download the PDB-style file with coordinates for d3l5qb_.
(The format of our PDB-style files is described here.)

Timeline for d3l5qb_: