Lineage for d1tehb1 (1teh B:3-174,B:325-374)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 165795Fold b.35: GroES-like [50128] (2 superfamilies)
  4. 165796Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 165846Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (5 proteins)
  6. 165847Protein Alcohol dehydrogenase [50137] (4 species)
  7. 165906Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (16 PDB entries)
  8. 165938Domain d1tehb1: 1teh B:3-174,B:325-374 [24734]
    Other proteins in same PDB: d1teha2, d1tehb2

Details for d1tehb1

PDB Entry: 1teh (more details), 2.7 Å

PDB Description: structure of human liver chichi alcohol dehydrogenase (a glutathione-dependent formaldehyde dehydrogenase)

SCOP Domain Sequences for d1tehb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tehb1 b.35.1.2 (B:3-174,B:325-374) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes}
anevikckaavaweagkplsieeievappkahevrikiiatavchtdaytlsgadpegcf
pvilghegagivesvgegvtklkagdtviplyipqcgeckfclnpktnlcqkirvtqgkg
lmpdgtsrftckgktilhymgtstfseytvvadisvakidplapldkvcllgcXvesvpk
lvseymskkikvdefvthnlsfdeinkafelmhsgksirtvvki

SCOP Domain Coordinates for d1tehb1:

Click to download the PDB-style file with coordinates for d1tehb1.
(The format of our PDB-style files is described here.)

Timeline for d1tehb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tehb2