Lineage for d3l4na_ (3l4n A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133854Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2133855Protein automated matches [190056] (165 species)
    not a true protein
  7. 2134015Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [195631] (4 PDB entries)
  8. 2134016Domain d3l4na_: 3l4n A: [247331]
    automated match to d4mzca_
    complexed with gsh

Details for d3l4na_

PDB Entry: 3l4n (more details), 1.5 Å

PDB Description: Crystal structure of yeast monothiol glutaredoxin Grx6
PDB Compounds: (A:) Monothiol glutaredoxin-6

SCOPe Domain Sequences for d3l4na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l4na_ c.47.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
fnvqkeyslildlspiiifskstcsyskgmkelleneyqfipnyyiieldkhghgeelqe
yiklvtgrgtvpnllvngvsrggneeikklhtqgklleslqvwsdgkfsveqr

SCOPe Domain Coordinates for d3l4na_:

Click to download the PDB-style file with coordinates for d3l4na_.
(The format of our PDB-style files is described here.)

Timeline for d3l4na_: