Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (165 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [195631] (4 PDB entries) |
Domain d3l4na_: 3l4n A: [247331] automated match to d4mzca_ complexed with gsh |
PDB Entry: 3l4n (more details), 1.5 Å
SCOPe Domain Sequences for d3l4na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l4na_ c.47.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} fnvqkeyslildlspiiifskstcsyskgmkelleneyqfipnyyiieldkhghgeelqe yiklvtgrgtvpnllvngvsrggneeikklhtqgklleslqvwsdgkfsveqr
Timeline for d3l4na_: