Lineage for d3l20a_ (3l20 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1900809Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 1900810Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 1901256Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. 1901257Protein automated matches [190239] (18 species)
    not a true protein
  7. 1901388Species Staphylococcus aureus [TaxId:367830] [255916] (1 PDB entry)
  8. 1901389Domain d3l20a_: 3l20 A: [247327]
    automated match to d1u6la_

Details for d3l20a_

PDB Entry: 3l20 (more details), 2.45 Å

PDB Description: crystal structure of a hypothetical protein from staphylococcus aureus
PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d3l20a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l20a_ d.32.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 367830]}
gshmfymtalfpyiafenskealayyeevfgatdvkrlevgeeqashfgmtkeeaqeatm
haefevlgvkvlcsdsfgradkinngisllidydvnnkedadkveafyeqikdhssieie
lpfadqfwggkmgvftdkygvrwmlhgqdytaiq

SCOPe Domain Coordinates for d3l20a_:

Click to download the PDB-style file with coordinates for d3l20a_.
(The format of our PDB-style files is described here.)

Timeline for d3l20a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3l20b_