Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.0: automated matches [191344] (1 protein) not a true family |
Protein automated matches [190239] (18 species) not a true protein |
Species Staphylococcus aureus [TaxId:367830] [255916] (1 PDB entry) |
Domain d3l20a_: 3l20 A: [247327] automated match to d1u6la_ |
PDB Entry: 3l20 (more details), 2.45 Å
SCOPe Domain Sequences for d3l20a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l20a_ d.32.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 367830]} gshmfymtalfpyiafenskealayyeevfgatdvkrlevgeeqashfgmtkeeaqeatm haefevlgvkvlcsdsfgradkinngisllidydvnnkedadkveafyeqikdhssieie lpfadqfwggkmgvftdkygvrwmlhgqdytaiq
Timeline for d3l20a_: