SCOPe 2.08: Domain d3l1za1: 3l1z A:1-147

Lineage for d3l1za1 (3l1z A:1-147)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186848] (52 PDB entries)

8. Domain d3l1za1: 3l1z A:1-147 [247326]
   Other proteins in same PDB: d3l1za2, d3l1zb_
   automated match to d3l1ya_

Details for d3l1za1

PDB Entry: 3l1z, 3.17 Å

PDB Description: Crystal structure of the U-BOX domain of human E4B ubiquitin ligase in complex with UBCH5C E2 ubiquitin conjugating enzyme

PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 D3

SCOPe Domain Sequences for d3l1za1:

Sequence; same for both SEQRES and ATOM records:

>d3l1za1 d.20.1.1 (A:1-147) automated matches {Human (Homo sapiens) [TaxId: 9606]}
malkrinkelsdlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdy
pfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplv
peiariyktdrdkynrisrewtqkyam

Timeline for d3l1za1:

• d3l1za1 first appeared in SCOPe 2.04, called d3l1za_
  
• d3l1za1 appears in SCOPe 2.07