SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3l13a1 (3l13 A:144-321)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2158220Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2159292Family d.15.1.5: Ras-binding domain, RBD [54263] (14 protein domains)
    contains Pfam PF00788 and Pfam PF02196
  6. 2159312Protein Phoshoinositide 3-kinase (PI3K) [54274] (2 species)
    includes parts of the flanking linkers
  7. 2159313Species Human (Homo sapiens) [TaxId:9606] [54276] (61 PDB entries)
  8. 2159364Domain d3l13a1: 3l13 A:144-321 [247311]
    Other proteins in same PDB: d3l13a2, d3l13a3, d3l13a4, d3l13a5
    automated match to d1e7ua3
    complexed with jzw

Details for d3l13a1

PDB Entry: 3l13 (more details), 3 Å

PDB Description: Crystal Structures of Pan-PI3-Kinase and Dual Pan-PI3-Kinase/mTOR Inhibitors
PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d3l13a1:

Sequence, based on SEQRES records: (download)

>d3l13a1 d.15.1.5 (A:144-321) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]}
seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdipe
sqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrke

Sequence, based on observed residues (ATOM records): (download)

>d3l13a1 d.15.1.5 (A:144-321) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]}
seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmaeqdfvlrvcg
rdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrke

SCOPe Domain Coordinates for d3l13a1:

Click to download the PDB-style file with coordinates for d3l13a1.
(The format of our PDB-style files is described here.)

Timeline for d3l13a1: