SCOPe 2.08: Domain d1hsoa1: 1hso A:1-162,A:339-374

Lineage for d1hsoa1 (1hso A:1-162,A:339-374)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (3 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Alcohol dehydrogenase [50137] (9 species)
   contains a Zn-finger subdomain, residues 94-117

7. Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (24 PDB entries)
   Uniprot P00326 ! Uniprot P00325 ! Uniprot P07327

8. Domain d1hsoa1: 1hso A:1-162,A:339-374 [24731]
   Other proteins in same PDB: d1hsoa2, d1hsob2
   alpha isozyme
   complexed with nad, pyz, zn

Details for d1hsoa1

PDB Entry: 1hso, 2.5 Å

PDB Description: human alpha alcohol dehydrogenase (adh1a)

PDB Compounds: (A:) class I alcohol dehydrogenase 1, alpha subunit

SCOPe Domain Sequences for d1hsoa1:

Sequence; same for both SEQRES and ATOM records:

>d1hsoa1 b.35.1.2 (A:1-162,A:339-374) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}
stagkvikckaavlwelkkpfsieevevappkahevrikmvavgicgtddhvvsgtmvtp
lpvilgheaagivesvgegvttvkpgdkviplaipqcgkcricknpesnyclkndvsnpq
gtlqdgtsrftcrrkpihhflgistfsqytvvdenavakidaXkfsldalithvlpfeki
negfdllhsgksirtilmf

Timeline for d1hsoa1:

• d1hsoa1 first appeared (with stable ids) in SCOP 1.55
  
• d1hsoa1 appears in SCOPe 2.07