Lineage for d3kzhb_ (3kzh B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137471Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2137472Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2137707Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2137708Protein automated matches [190117] (40 species)
    not a true protein
  7. 2137752Species Clostridium perfringens [TaxId:1502] [255915] (1 PDB entry)
  8. 2137754Domain d3kzhb_: 3kzh B: [247306]
    automated match to d2nwha_
    complexed with bgc

Details for d3kzhb_

PDB Entry: 3kzh (more details), 2.45 Å

PDB Description: Crystal structure of a putative sugar kinase from Clostridium perfringens
PDB Compounds: (B:) Probable sugar kinase

SCOPe Domain Sequences for d3kzhb_:

Sequence, based on SEQRES records: (download)

>d3kzhb_ c.72.1.0 (B:) automated matches {Clostridium perfringens [TaxId: 1502]}
kepyllvfgasvvdvfgfskasyrpynstpghvkisfggvcrniaenmarvgvntnfmsi
lgndehgksivehskkigyhmddsmvieggstptylaildengemvsaiadmksigamnt
dfidskreifenaeytvldsdnpeimeyllknfkdktnfildpvsaekaswvkhlikdfh
tikpnrheaeilagfpitdtddlikasnyflglgikkvfisldadgifyndgvscgkika
tevdvknvtgagdsfvaglgygymnkmpiedivkfamtmsnitisheetihpdmaldtvl
aklekttweeekydl

Sequence, based on observed residues (ATOM records): (download)

>d3kzhb_ c.72.1.0 (B:) automated matches {Clostridium perfringens [TaxId: 1502]}
kepyllvfgasvvdvfgfskasyrpynstpghvkisfggvcrniaenmarvgvntnfmsi
lgndehgksivehskkigyhmddsmvieggstptylaildengemvsaiadmksigamnt
dfidskreifenaeytvldsdnpeimeyllknfkdktnfildpvsaekaswvkhlikdfh
tikpnrheaeilagfpitdtddlikasnyflglgikkvfisldadgifyndgvscgkika
tevdvknvtgagdsfvaglgygymnkmpiedivkfamtmsnitisheeihpdmaldtvla
klekttweeekydl

SCOPe Domain Coordinates for d3kzhb_:

Click to download the PDB-style file with coordinates for d3kzhb_.
(The format of our PDB-style files is described here.)

Timeline for d3kzhb_: