Lineage for d3kzha_ (3kzh A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2478216Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2478217Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2478486Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2478487Protein automated matches [190117] (42 species)
    not a true protein
  7. 2478534Species Clostridium perfringens [TaxId:1502] [255915] (1 PDB entry)
  8. 2478535Domain d3kzha_: 3kzh A: [247305]
    automated match to d2nwha_
    complexed with bgc

Details for d3kzha_

PDB Entry: 3kzh (more details), 2.45 Å

PDB Description: Crystal structure of a putative sugar kinase from Clostridium perfringens
PDB Compounds: (A:) Probable sugar kinase

SCOPe Domain Sequences for d3kzha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kzha_ c.72.1.0 (A:) automated matches {Clostridium perfringens [TaxId: 1502]}
rkepyllvfgasvvdvfgfskasyrpynstpghvkisfggvcrniaenmarvgvntnfms
ilgndehgksivehskkigyhmddsmvieggstptylaildengemvsaiadmksigamn
tdfidskreifenaeytvldsdnpeimeyllknfkdktnfildpvsaekaswvkhlikdf
htikpnrheaeilagfpitdtddlikasnyflglgikkvfisldadgifyndgvscgkik
atevdvknvtgagdsfvaglgygymnkmpiedivkfamtmsnitisheetihpdmaldtv
laklekttweeekydl

SCOPe Domain Coordinates for d3kzha_:

Click to download the PDB-style file with coordinates for d3kzha_.
(The format of our PDB-style files is described here.)

Timeline for d3kzha_: