SCOPe 2.08: Domain d3kzha_: 3kzh A:

Lineage for d3kzha_ (3kzh A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.0: automated matches [191321] (1 protein)
   not a true family

6. Protein automated matches [190117] (50 species)
   not a true protein

7. Species Clostridium perfringens [TaxId:1502] [255915] (1 PDB entry)

8. Domain d3kzha_: 3kzh A: [247305]
   automated match to d2nwha_
   complexed with bgc

Details for d3kzha_

PDB Entry: 3kzh, 2.45 Å

PDB Description: crystal structure of a putative sugar kinase from clostridium perfringens

PDB Compounds: (A:) Probable sugar kinase

SCOPe Domain Sequences for d3kzha_:

Sequence; same for both SEQRES and ATOM records:

>d3kzha_ c.72.1.0 (A:) automated matches {Clostridium perfringens [TaxId: 1502]}
rkepyllvfgasvvdvfgfskasyrpynstpghvkisfggvcrniaenmarvgvntnfms
ilgndehgksivehskkigyhmddsmvieggstptylaildengemvsaiadmksigamn
tdfidskreifenaeytvldsdnpeimeyllknfkdktnfildpvsaekaswvkhlikdf
htikpnrheaeilagfpitdtddlikasnyflglgikkvfisldadgifyndgvscgkik
atevdvknvtgagdsfvaglgygymnkmpiedivkfamtmsnitisheetihpdmaldtv
laklekttweeekydl

Timeline for d3kzha_:

• d3kzha_ first appeared in SCOPe 2.04
  
• d3kzha_ appears in SCOPe 2.07